PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1720580.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YB
Protein Properties Length: 195aa    MW: 20757 Da    PI: 6.7938
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1720580.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.91.4e-5824119297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPianvsrimkk+lPan+kisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg
  Lj6g3v1720580.3  24 REQDRFLPIANVSRIMKKALPANGKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLHKYREMEG 117
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  Lj6g3v1720580.3 118 EK 119
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.1E-5522128IPR009072Histone-fold
SuperFamilySSF471138.85E-4226130IPR009072Histone-fold
PfamPF008082.9E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.7E-215775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.7E-217694No hitNo description
PRINTSPR006153.7E-2195113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MAESDNESGG QTGGGHTGEL LGCREQDRFL PIANVSRIMK KALPANGKIS KEAKETVQEC  60
VSEFISFITG EASDKCQKEK RKTINGDDLL WAMTTLGFED YVEPLKIYLH KYREMEGEKT  120
GGMVQSGGGG GGGGGGGRSQ SEQRDLNNAA GESYGHGMPS SHHVMMMMGH HQHQSHMYGG  180
SGSGSGSPSS GRSTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4924114292Transcription factor HapC (Eurofung)
4g92_B1e-4924114292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147615.17e-80hypothetical protein PHAVU_006G139400g
SwissprotO233103e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A151R1B17e-83A0A151R1B1_CAJCA; Nuclear transcription factor Y subunit B-3
STRINGGLYMA15G12570.16e-79(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-67nuclear factor Y, subunit B3